Lineage for d1sqbc2 (1sqb C:2-260)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456466Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1456467Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1456473Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1456485Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 1456511Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries)
    Uniprot P00157
  8. 1456525Domain d1sqbc2: 1sqb C:2-260 [105895]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbc2

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbc2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

SCOPe Domain Coordinates for d1sqbc2:

Click to download the PDB-style file with coordinates for d1sqbc2.
(The format of our PDB-style files is described here.)

Timeline for d1sqbc2: