![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56000] (17 PDB entries) Uniprot P23004 |
![]() | Domain d1sqbb2: 1sqb B:236-439 [105893] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOPe Domain Sequences for d1sqbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak kfvsgrksmaasgnlghtpfidel
Timeline for d1sqbb2: