Lineage for d1sqba2 (1sqb A:234-446)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611060Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 2611089Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries)
    Uniprot P31800
  8. 2611115Domain d1sqba2: 1sqb A:234-446 [105891]
    Other proteins in same PDB: d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqba2

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (A:) Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d1sqba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqba2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOPe Domain Coordinates for d1sqba2:

Click to download the PDB-style file with coordinates for d1sqba2.
(The format of our PDB-style files is described here.)

Timeline for d1sqba2: