Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Novel antigen receptor (against lysozyme) [110042] (1 species) |
Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries) Uniprot Q8AXI4 # fragment |
Domain d1sq2n_: 1sq2 N: [105881] Other proteins in same PDB: d1sq2l_ complexed with cl, edo |
PDB Entry: 1sq2 (more details), 1.45 Å
SCOPe Domain Sequences for d1sq2n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn
Timeline for d1sq2n_: