Lineage for d1snxa_ (1snx A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512517Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 512518Species Human (Homo sapiens) [TaxId:9606] [111195] (3 PDB entries)
  8. 512523Domain d1snxa_: 1snx A: [105831]

Details for d1snxa_

PDB Entry: 1snx (more details), 3.2 Å

PDB Description: crystal structure of apo interleukin-2 tyrosine kinase catalytic domain

SCOP Domain Sequences for d1snxa_:

Sequence, based on SEQRES records: (download)

>d1snxa_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens)}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records): (download)

>d1snxa_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens)}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
iaesg

SCOP Domain Coordinates for d1snxa_:

Click to download the PDB-style file with coordinates for d1snxa_.
(The format of our PDB-style files is described here.)

Timeline for d1snxa_:

Domains from other chains:
(mouse over for more information)
d1snxb_