Lineage for d1smyl2 (1smy L:50-172)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515294Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 515295Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 515296Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 515297Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 515306Species Thermus thermophilus [TaxId:274] [75595] (2 PDB entries)
  8. 515310Domain d1smyl2: 1smy L:50-172 [105787]
    Other proteins in same PDB: d1smya1, d1smyb1, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyl1, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3

Details for d1smyl2

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyl2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d1smyl2:

Click to download the PDB-style file with coordinates for d1smyl2.
(The format of our PDB-style files is described here.)

Timeline for d1smyl2: