SCOP 1.75: Domain d1sm1l_: 1sm1 L:

Lineage for d1sm1l_ (1sm1 L:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1sm1l_: 1sm1 L: [105740]

Details for d1sm1l_

PDB Entry: 1sm1, 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

PDB Compounds: (L:) 50S ribosomal protein L17

SCOP Domain Sequences for d1sm1l_:

Sequence; same for both SEQRES and ATOM records:

>d1sm1l_ i.1.1.2 (L:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

Timeline for d1sm1l_:

• d1sm1l_ first appeared in SCOP 1.69
  
• d1sm1l_ appears in SCOP 1.73
  
• d1sm1l_ appears in SCOPe 2.01
  
• d1sm1l_ appears in the current release, SCOPe 2.08