Lineage for d1sm1a_ (1sm1 A:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1711240Domain d1sm1a_: 1sm1 A: [105729]
    complexed with dol

Details for d1sm1a_

PDB Entry: 1sm1 (more details), 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin
PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1sm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm1a_ i.1.1.2 (A:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
rvpvtpwgkptkglktrrkrktsdrfivtr

SCOPe Domain Coordinates for d1sm1a_:

Click to download the PDB-style file with coordinates for d1sm1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sm1a_: