SCOPe 2.03: Domain d1sm12_: 1sm1 2:

Lineage for d1sm12_ (1sm1 2:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1sm12_: 1sm1 2: [105726]
   complexed with dol

Details for d1sm12_

PDB Entry: 1sm1, 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1sm12_:

Sequence; same for both SEQRES and ATOM records:

>d1sm12_ i.1.1.2 (2:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

Timeline for d1sm12_:

• d1sm12_ first appeared in SCOP 1.69
  
• d1sm12_ appears in SCOPe 2.02
  
• d1sm12_ appears in SCOPe 2.04
  
• d1sm12_ appears in the current release, SCOPe 2.08