Lineage for d1sl6c_ (1sl6 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614364Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. 614365Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
  8. 614370Domain d1sl6c_: 1sl6 C: [105714]

Details for d1sl6c_

PDB Entry: 1sl6 (more details), 2.25 Å

PDB Description: crystal structure of a fragment of dc-signr (containg the carbohydrate recognition domain and two repeats of the neck) complexed with lewis- x.

SCOP Domain Sequences for d1sl6c_:

Sequence, based on SEQRES records: (download)

>d1sl6c_ d.169.1.1 (C:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn
cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt
wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Sequence, based on observed residues (ATOM records): (download)

>d1sl6c_ d.169.1.1 (C:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

SCOP Domain Coordinates for d1sl6c_:

Click to download the PDB-style file with coordinates for d1sl6c_.
(The format of our PDB-style files is described here.)

Timeline for d1sl6c_: