SCOP 1.73: Domain d1sl2b_: 1sl2 B:

Lineage for d1sl2b_ (1sl2 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Escherichia coli [TaxId:562] [52836] (29 PDB entries)

8. Domain d1sl2b_: 1sl2 B: [105708]
   Other proteins in same PDB: d1sl2a1, d1sl2a2
   complexed with 2da, dad, mg, ttd; mutant

Details for d1sl2b_

PDB Entry: 1sl2, 2.3 Å

PDB Description: Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide

PDB Compounds: (B:) Thioredoxin 1

SCOP Domain Sequences for d1sl2b_:

Sequence; same for both SEQRES and ATOM records:

>d1sl2b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1sl2b_:

• d1sl2b_ first appeared in SCOP 1.69
  
• d1sl2b_ appears in SCOP 1.71
  
• d1sl2b_ appears in SCOP 1.75
  
• d1sl2b_ appears in the current release, SCOPe 2.08