Lineage for d1sl2a2 (1sl2 A:211-704)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2247105Protein T7 phage DNA polymerase [56678] (1 species)
  7. 2247106Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries)
    Uniprot P00581
  8. 2247116Domain d1sl2a2: 1sl2 A:211-704 [105707]
    Other proteins in same PDB: d1sl2a1, d1sl2b_
    protein/DNA complex; complexed with dad, mg

Details for d1sl2a2

PDB Entry: 1sl2 (more details), 2.3 Å

PDB Description: Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1sl2a2:

Sequence, based on SEQRES records: (download)

>d1sl2a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

Sequence, based on observed residues (ATOM records): (download)

>d1sl2a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggildtreyvagapytpvehvvfnpssrdhiqkklq
eagwvptkytdkgapvvddevlegvrvddpekqaaidlikeylmiqkrigqsaegdkawl
ryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeqcraafgaehhldgitgk
pwvqagidasglelrclahfmarfdngeyaheilngdihtknqiaaelptrdnaktfiyg
flydekigqivgagkergkelkkkflentpaiaalresiqqtlvekwkrrwikgldgrkv
hvrsphaalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcr
teeiaqvvietaqeamrwvgdhwnfrclldtegkmgpnwaich

SCOPe Domain Coordinates for d1sl2a2:

Click to download the PDB-style file with coordinates for d1sl2a2.
(The format of our PDB-style files is described here.)

Timeline for d1sl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sl2a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sl2b_