Lineage for d1skwa1 (1skw A:1-210)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2140015Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 2140016Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
    Uniprot P00581
  8. 2140028Domain d1skwa1: 1skw A:1-210 [105694]
    Other proteins in same PDB: d1skwa2, d1skwb_
    protein/DNA complex; complexed with mg

Details for d1skwa1

PDB Entry: 1skw (more details), 2.3 Å

PDB Description: Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1skwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skwa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOPe Domain Coordinates for d1skwa1:

Click to download the PDB-style file with coordinates for d1skwa1.
(The format of our PDB-style files is described here.)

Timeline for d1skwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1skwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1skwb_