Lineage for d1sksb_ (1sks B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486472Family c.47.1.1: Thioltransferase [52834] (11 proteins)
  6. 486522Protein Thioredoxin [52835] (10 species)
  7. 486547Species Escherichia coli [TaxId:562] [52836] (21 PDB entries)
  8. 486562Domain d1sksb_: 1sks B: [105689]
    Other proteins in same PDB: d1sksa1, d1sksa2

Details for d1sksb_

PDB Entry: 1sks (more details), 2.3 Å

PDB Description: Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn thymine dimer on the template

SCOP Domain Sequences for d1sksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sksb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOP Domain Coordinates for d1sksb_:

Click to download the PDB-style file with coordinates for d1sksb_.
(The format of our PDB-style files is described here.)

Timeline for d1sksb_: