| Class b: All beta proteins [48724] (144 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (2 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (8 proteins) |
| Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species) eukaryotic and archaeal homologue of EF-Tu |
| Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries) |
| Domain d1skqb1: 1skq B:228-322 [105681] Other proteins in same PDB: d1skqa2, d1skqa3, d1skqb2, d1skqb3 |
PDB Entry: 1skq (more details), 1.8 Å
SCOP Domain Sequences for d1skqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skqb1 b.43.3.1 (B:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv
Timeline for d1skqb1: