SCOP 1.69: Domain d1skqa3: 1skq A:4-227

Lineage for d1skqa3 (1skq A:4-227)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69487] (2 PDB entries)

8. Domain d1skqa3: 1skq A:4-227 [105680]
   Other proteins in same PDB: d1skqa1, d1skqa2, d1skqb1, d1skqb2

Details for d1skqa3

PDB Entry: 1skq, 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp

SCOP Domain Sequences for d1skqa3:

Sequence, based on SEQRES records:

>d1skqa3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppk

Sequence, based on observed residues (ATOM records):

>d1skqa3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eemrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtre
hiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvva
psgdnithksenmkwyngptleeyldqlelppk

Timeline for d1skqa3:

• d1skqa3 is new in SCOP 1.69
  
• d1skqa3 appears in SCOP 1.71
  
• d1skqa3 appears in the current release, SCOPe 2.08