Class b: All beta proteins [48724] (144 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins) |
Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries) |
Domain d1skqa2: 1skq A:323-430 [105679] Other proteins in same PDB: d1skqa1, d1skqa3, d1skqb1, d1skqb3 |
PDB Entry: 1skq (more details), 1.8 Å
SCOP Domain Sequences for d1skqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skqa2 b.44.1.1 (A:323-430) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus} adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa
Timeline for d1skqa2: