SCOP 1.69: Domain d1skqa1: 1skq A:228-322

Lineage for d1skqa1 (1skq A:228-322)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (8 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69276] (2 PDB entries)

8. Domain d1skqa1: 1skq A:228-322 [105678]
   Other proteins in same PDB: d1skqa2, d1skqa3, d1skqb2, d1skqb3

Details for d1skqa1

PDB Entry: 1skq, 1.8 Å

PDB Description: the crystal structure of sulfolobus solfataricus elongation factor 1- alpha in complex with magnesium and gdp

SCOP Domain Sequences for d1skqa1:

Sequence; same for both SEQRES and ATOM records:

>d1skqa1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus}
pvdkplripiqdvysisgvgtvpvgrvesgvlkvgdkivfmpagkvgevrsiethhtkmd
kaepgdnigfnvrgvekkdikrgdvvghpnnpptv

Timeline for d1skqa1:

• d1skqa1 is new in SCOP 1.69
  
• d1skqa1 appears in SCOP 1.71
  
• d1skqa1 appears in the current release, SCOPe 2.08