![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (10 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47517] (11 PDB entries) |
![]() | Domain d1sk6f_: 1sk6 F: [105670] Other proteins in same PDB: d1sk6a_, d1sk6b_, d1sk6c_ complexed with ca, cmp, pop, yb |
PDB Entry: 1sk6 (more details), 3.2 Å
SCOP Domain Sequences for d1sk6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sk6f_ a.39.1.5 (F:) Calmodulin {Human (Homo sapiens)} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmta
Timeline for d1sk6f_: