SCOPe 2.05: Domain d1sjqa_: 1sjq A:

Lineage for d1sjqa_ (1sjq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Polypyrimidine tract-binding protein [54950] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
   Uniprot P26599 54-141, 177-284, 335-531

8. Domain d1sjqa_: 1sjq A: [105660]
   RR1

Details for d1sjqa_

PDB Entry: 1sjq

PDB Description: nmr structure of rrm1 from human polypyrimidine tract binding protein isoform 1 (ptb1)

PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d1sjqa_:

Sequence; same for both SEQRES and ATOM records:

>d1sjqa_ d.58.7.1 (A:) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
sgvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaantmvny
ytsvtpvlrgqpiyiqfsnhkelktdss

Timeline for d1sjqa_:

• d1sjqa_ first appeared in SCOP 1.69
  
• d1sjqa_ appears in SCOPe 2.04
  
• d1sjqa_ is called d1sjqa1 in SCOPe 2.06
  
• d1sjqa_ appears in the current release, SCOPe 2.08, called d1sjqa1