Lineage for d1sjqa_ (1sjq A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724485Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 724486Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
  8. 724491Domain d1sjqa_: 1sjq A: [105660]
    RR1

Details for d1sjqa_

PDB Entry: 1sjq (more details)

PDB Description: nmr structure of rrm1 from human polypyrimidine tract binding protein isoform 1 (ptb1)
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOP Domain Sequences for d1sjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjqa_ d.58.7.1 (A:) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
sgvpsrvihirklpidvtegevislglpfgkvtnllmlkgknqafiemnteeaantmvny
ytsvtpvlrgqpiyiqfsnhkelktdss

SCOP Domain Coordinates for d1sjqa_:

Click to download the PDB-style file with coordinates for d1sjqa_.
(The format of our PDB-style files is described here.)

Timeline for d1sjqa_: