Lineage for d1sjhd2 (1sjh D:122-239)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639269Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1639270Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
    Uniprot P23313
  8. 1639283Domain d1sjhd2: 1sjh D:122-239 [105653]
    Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhb2, d1sjhd1

Details for d1sjhd2

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1sjhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjhd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1sjhd2:

Click to download the PDB-style file with coordinates for d1sjhd2.
(The format of our PDB-style files is described here.)

Timeline for d1sjhd2: