SCOPe 2.03: Domain d1sjhd1: 1sjh D:1-121

Lineage for d1sjhd1 (1sjh D:1-121)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries)
   Uniprot P23313

8. Domain d1sjhd1: 1sjh D:1-121 [105652]
   Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhb2, d1sjhd2

Details for d1sjhd1

PDB Entry: 1sjh, 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1sjhd1:

Sequence, based on SEQRES records:

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records):

>d1sjhd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

Timeline for d1sjhd1:

• d1sjhd1 first appeared in SCOP 1.69
  
• d1sjhd1 appears in SCOPe 2.02
  
• d1sjhd1 appears in SCOPe 2.04
  
• d1sjhd1 appears in the current release, SCOPe 2.08