Lineage for d1sjhb2 (1sjh B:1-92)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719844Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 719875Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (12 PDB entries)
  8. 719878Domain d1sjhb2: 1sjh B:1-92 [105651]
    Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhd1, d1sjhd2
    mutant

Details for d1sjhb2

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d1sjhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjhb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1sjhb2:

Click to download the PDB-style file with coordinates for d1sjhb2.
(The format of our PDB-style files is described here.)

Timeline for d1sjhb2: