Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries) Uniprot P04229 30-219 |
Domain d1sjhb2: 1sjh B:1-92 [105651] Other proteins in same PDB: d1sjha1, d1sjha2, d1sjhb1, d1sjhd1, d1sjhd2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1sjh (more details), 2.25 Å
SCOPe Domain Sequences for d1sjhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjhb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1sjhb2:
View in 3D Domains from other chains: (mouse over for more information) d1sjha1, d1sjha2, d1sjhd1, d1sjhd2 |