Lineage for d1sjha1 (1sjh A:82-181)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654857Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 654864Domain d1sjha1: 1sjh A:82-181 [105648]
    Other proteins in same PDB: d1sjha2, d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2
    mutant

Details for d1sjha1

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d1sjha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjha1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1sjha1:

Click to download the PDB-style file with coordinates for d1sjha1.
(The format of our PDB-style files is described here.)

Timeline for d1sjha1: