Lineage for d1sjed1 (1sje D:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314320Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 1314321Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries)
    Uniprot P23313
  8. 1314328Domain d1sjed1: 1sje D:1-121 [105644]
    Other proteins in same PDB: d1sjea1, d1sjea2, d1sjeb1, d1sjeb2, d1sjed2

Details for d1sjed1

PDB Entry: 1sje (more details), 2.45 Å

PDB Description: hla-dr1 complexed with a 16 residue hiv capsid peptide bound in a hairpin conformation
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1sjed1:

Sequence, based on SEQRES records: (download)

>d1sjed1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1sjed1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOPe Domain Coordinates for d1sjed1:

Click to download the PDB-style file with coordinates for d1sjed1.
(The format of our PDB-style files is described here.)

Timeline for d1sjed1: