SCOPe 2.04: Domain d1siwc_: 1siw C:

Lineage for d1siwc_ (1siw C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
   automatically mapped to Pfam PF02665

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)

6. Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)

7. Species Escherichia coli [TaxId:562] [103504] (6 PDB entries)
   Uniprot P11350

8. Domain d1siwc_: 1siw C: [105592]
   Other proteins in same PDB: d1siwa1, d1siwa2, d1siwb_
   complexed with 3ph, f3s, gdp, hem, sf4

Details for d1siwc_

PDB Entry: 1siw, 2.2 Å

PDB Description: crystal structure of the apomolybdo-narghi

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d1siwc_:

Sequence, based on SEQRES records:

>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records):

>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgad
ililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrl
hlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d1siwc_:

• d1siwc_ first appeared in SCOP 1.69
  
• d1siwc_ appears in SCOPe 2.03
  
• d1siwc_ appears in SCOPe 2.05
  
• d1siwc_ appears in the current release, SCOPe 2.08