Lineage for d1siwc_ (1siw C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519804Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 519882Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) (S)
    possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
  5. 519883Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (1 protein)
  6. 519884Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)
  7. 519885Species Escherichia coli [TaxId:562] [103504] (2 PDB entries)
  8. 519887Domain d1siwc_: 1siw C: [105592]
    Other proteins in same PDB: d1siwa1, d1siwa2, d1siwb_

Details for d1siwc_

PDB Entry: 1siw (more details), 2.2 Å

PDB Description: Crystal structure of the apomolybdo-NarGHI

SCOP Domain Sequences for d1siwc_:

Sequence, based on SEQRES records: (download)

>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records): (download)

>d1siwc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgad
ililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrl
hlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

SCOP Domain Coordinates for d1siwc_:

Click to download the PDB-style file with coordinates for d1siwc_.
(The format of our PDB-style files is described here.)

Timeline for d1siwc_: