Lineage for d1siwb_ (1siw B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 503918Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 504015Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 504065Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)
  7. 504066Species Escherichia coli [TaxId:562] [102956] (3 PDB entries)
  8. 504070Domain d1siwb_: 1siw B: [105591]
    Other proteins in same PDB: d1siwa1, d1siwa2, d1siwc_

Details for d1siwb_

PDB Entry: 1siw (more details), 2.2 Å

PDB Description: Crystal structure of the apomolybdo-NarGHI

SCOP Domain Sequences for d1siwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siwb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskt

SCOP Domain Coordinates for d1siwb_:

Click to download the PDB-style file with coordinates for d1siwb_.
(The format of our PDB-style files is described here.)

Timeline for d1siwb_: