Lineage for d1siwa1 (1siw A:1075-1243)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563620Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 563643Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 563667Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 563715Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)
  7. 563716Species Escherichia coli [TaxId:562] [101829] (3 PDB entries)
  8. 563720Domain d1siwa1: 1siw A:1075-1243 [105589]
    Other proteins in same PDB: d1siwa2, d1siwb_, d1siwc_
    complexed with 3ph, f3s, gdp, hem, sf4

Details for d1siwa1

PDB Entry: 1siw (more details), 2.2 Å

PDB Description: Crystal structure of the apomolybdo-NarGHI

SCOP Domain Sequences for d1siwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siwa1 b.52.2.2 (A:1075-1243) Respiratory nitrate reductase 1 alpha chain {Escherichia coli}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqe

SCOP Domain Coordinates for d1siwa1:

Click to download the PDB-style file with coordinates for d1siwa1.
(The format of our PDB-style files is described here.)

Timeline for d1siwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1siwa2