SCOPe 2.08: Domain d1si1a_: 1si1 A:

Lineage for d1si1a_ (1si1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Mannheimia haemolytica [TaxId:75985] [102691] (3 PDB entries)
   Uniprot Q9Z4N6

8. Domain d1si1a_: 1si1 A: [105568]
   complexed with fe
   has additional insertions and/or extensions that are not grouped together

Details for d1si1a_

PDB Entry: 1si1, 1.45 Å

PDB Description: Crystal Structure of Mannheimia haemolytica Ferric iron-Binding Protein A in an open conformation

PDB Compounds: (A:) iron binding protein FbpA

SCOPe Domain Sequences for d1si1a_:

Sequence; same for both SEQRES and ATOM records:

>d1si1a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}
anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi
srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd
yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd
qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs
pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn
yeaalklvdevkfddf

Timeline for d1si1a_:

• d1si1a_ first appeared in SCOP 1.69
  
• d1si1a_ appears in SCOPe 2.07