Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.274: Hypothetical protein PF0899 [111056] (1 superfamily) alpha-beta-alpha-beta(4); 2 layers: a/b; mixed beta-sheet, order 23145, strands 1 and 3 are parallel; similar to the GAPDH C-terminal domain-like fold (scop_cf 55346) |
Superfamily d.274.1: Hypothetical protein PF0899 [111057] (1 family) |
Family d.274.1.1: Hypothetical protein PF0899 [111058] (1 protein) |
Protein Hypothetical protein PF0899 [111059] (1 species) |
Species Pyrococcus furiosus [TaxId:186497] [111060] (1 PDB entry) |
Domain d1shea_: 1she A: [105551] Structural genomics target complexed with au |
PDB Entry: 1she (more details), 1.85 Å
SCOP Domain Sequences for d1shea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1shea_ d.274.1.1 (A:) Hypothetical protein PF0899 {Pyrococcus furiosus} strgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsni kieileelggdavvidskvlglvpgaakrikiik
Timeline for d1shea_: