Lineage for d1shea_ (1she A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617140Fold d.274: Hypothetical protein PF0899 [111056] (1 superfamily)
    alpha-beta-alpha-beta(4); 2 layers: a/b; mixed beta-sheet, order 23145, strands 1 and 3 are parallel; similar to the GAPDH C-terminal domain-like fold (scop_cf 55346)
  4. 617141Superfamily d.274.1: Hypothetical protein PF0899 [111057] (1 family) (S)
  5. 617142Family d.274.1.1: Hypothetical protein PF0899 [111058] (1 protein)
  6. 617143Protein Hypothetical protein PF0899 [111059] (1 species)
  7. 617144Species Pyrococcus furiosus [TaxId:186497] [111060] (1 PDB entry)
  8. 617145Domain d1shea_: 1she A: [105551]
    Structural genomics target
    complexed with au

Details for d1shea_

PDB Entry: 1she (more details), 1.85 Å

PDB Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-871755-001

SCOP Domain Sequences for d1shea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shea_ d.274.1.1 (A:) Hypothetical protein PF0899 {Pyrococcus furiosus}
strgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsni
kieileelggdavvidskvlglvpgaakrikiik

SCOP Domain Coordinates for d1shea_:

Click to download the PDB-style file with coordinates for d1shea_.
(The format of our PDB-style files is described here.)

Timeline for d1shea_: