Lineage for d1sgja_ (1sgj A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476092Family c.1.12.5: HpcH/HpaI aldolase [51638] (3 proteins)
    forms a swapped dimer; contains a PK-type metal-binding site
  6. 476099Protein Citrate lyase, beta subunit [110375] (1 species)
    non-swapped trimer
  7. 476100Species Deinococcus radiodurans [TaxId:1299] [110376] (1 PDB entry)
  8. 476101Domain d1sgja_: 1sgj A: [105535]

Details for d1sgja_

PDB Entry: 1sgj (more details), 1.84 Å

PDB Description: crystal structure of citrate lyase beta subunit

SCOP Domain Sequences for d1sgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgja_ c.1.12.5 (A:) Citrate lyase, beta subunit {Deinococcus radiodurans}
ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg

SCOP Domain Coordinates for d1sgja_:

Click to download the PDB-style file with coordinates for d1sgja_.
(The format of our PDB-style files is described here.)

Timeline for d1sgja_: