Lineage for d1sg1x3 (1sg1 X:96-137)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523386Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 523387Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 523388Family g.24.1.1: TNF receptor-like [57587] (4 proteins)
    TNFR/NGFR cysteine-rich region (Pfam 00020)
  6. 523425Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species)
  7. 523426Species Rat (Rattus norvegicus) [TaxId:10116] [111414] (1 PDB entry)
  8. 523429Domain d1sg1x3: 1sg1 X:96-137 [105517]
    Other proteins in same PDB: d1sg1a_, d1sg1b_

Details for d1sg1x3

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75

SCOP Domain Sequences for d1sg1x3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg1x3 g.24.1.1 (X:96-137) Low affinity neurotrophin receptor p75NTR {Rat (Rattus norvegicus)}
acsvcevgsglvfscqdkqntvceecpegtysdeanhvdpcl

SCOP Domain Coordinates for d1sg1x3:

Click to download the PDB-style file with coordinates for d1sg1x3.
(The format of our PDB-style files is described here.)

Timeline for d1sg1x3: