Lineage for d1sg1b_ (1sg1 B:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891277Family g.17.1.3: Neurotrophin [57520] (4 proteins)
  6. 891278Protein beta-Nerve growth factor [57525] (2 species)
  7. 891279Species Human (Homo sapiens) [TaxId:9606] [57527] (3 PDB entries)
    Uniprot P01138
  8. 891283Domain d1sg1b_: 1sg1 B: [105514]
    Other proteins in same PDB: d1sg1x1, d1sg1x2, d1sg1x3, d1sg1x4
    complexed with cl

Details for d1sg1b_

PDB Entry: 1sg1 (more details), 2.4 Å

PDB Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
PDB Compounds: (B:) Beta-nerve growth factor

SCOP Domain Sequences for d1sg1b_:

Sequence, based on SEQRES records: (download)

>d1sg1b_ g.17.1.3 (B:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
rgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvdsgc
rgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

Sequence, based on observed residues (ATOM records): (download)

>d1sg1b_ g.17.1.3 (B:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
rgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidsk
hwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka

SCOP Domain Coordinates for d1sg1b_:

Click to download the PDB-style file with coordinates for d1sg1b_.
(The format of our PDB-style files is described here.)

Timeline for d1sg1b_: