Lineage for d1sfxa_ (1sfx A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635772Family a.4.5.50: TrmB-like [109680] (2 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families
  6. 635773Protein Hypothetical protein AF2008 [109681] (1 species)
  7. 635774Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)
  8. 635775Domain d1sfxa_: 1sfx A: [105505]

Details for d1sfxa_

PDB Entry: 1sfx (more details), 1.55 Å

PDB Description: x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
PDB Compounds: (A:) Conserved hypothetical protein AF2008

SCOP Domain Sequences for d1sfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}
hmsnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllk
rgfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftdgs

SCOP Domain Coordinates for d1sfxa_:

Click to download the PDB-style file with coordinates for d1sfxa_.
(The format of our PDB-style files is described here.)

Timeline for d1sfxa_: