SCOP 1.69: Domain d1sfxa_: 1sfx A:

Lineage for d1sfxa_ (1sfx A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.50: Hypothetical protein AF2008 [109680] (1 protein)
   The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families

6. Protein Hypothetical protein AF2008 [109681] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)

8. Domain d1sfxa_: 1sfx A: [105505]

Details for d1sfxa_

PDB Entry: 1sfx, 1.55 Å

PDB Description: x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus

SCOP Domain Sequences for d1sfxa_:

Sequence; same for both SEQRES and ATOM records:

>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus}
hmsnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllk
rgfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftdgs

Timeline for d1sfxa_:

• d1sfxa_ is new in SCOP 1.69
  
• d1sfxa_ appears in SCOP 1.71
  
• d1sfxa_ appears in the current release, SCOPe 2.08, called d1sfxa1