Lineage for d1seja1 (1sej A:3-180)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492479Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 492480Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 492481Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 492482Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (3 species)
  7. 492489Species Cryptosporidium hominis [TaxId:237895] [110705] (1 PDB entry)
  8. 492490Domain d1seja1: 1sej A:3-180 [105455]
    Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2

Details for d1seja1

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump

SCOP Domain Sequences for d1seja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOP Domain Coordinates for d1seja1:

Click to download the PDB-style file with coordinates for d1seja1.
(The format of our PDB-style files is described here.)

Timeline for d1seja1: