Lineage for d1sa3a_ (1sa3 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487731Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 487732Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families) (S)
  5. 487971Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein)
  6. 487972Protein Restriction endonuclease MspI [110625] (1 species)
  7. 487973Species Moraxella sp. [TaxId:479] [110626] (1 PDB entry)
  8. 487974Domain d1sa3a_: 1sa3 A: [105400]

Details for d1sa3a_

PDB Entry: 1sa3 (more details), 1.95 Å

PDB Description: an asymmetric complex of restriction endonuclease mspi on its palindromic dna recognition site

SCOP Domain Sequences for d1sa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa3a_ c.52.1.23 (A:) Restriction endonuclease MspI {Moraxella sp.}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg

SCOP Domain Coordinates for d1sa3a_:

Click to download the PDB-style file with coordinates for d1sa3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sa3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sa3b_