Lineage for d1s9xa1 (1s9x A:182-274)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026192Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2026387Domain d1s9xa1: 1s9x A:182-274 [105394]
    Other proteins in same PDB: d1s9xa2, d1s9xb1, d1s9xb2
    complexed with so4

Details for d1s9xa1

PDB Entry: 1s9x (more details), 2.5 Å

PDB Description: crystal structure analysis of ny-eso-1 epitope analogue, sllmwitqa, in complex with hla-a2
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1s9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9xa1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d1s9xa1:

Click to download the PDB-style file with coordinates for d1s9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1s9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s9xa2