Lineage for d1s8fb_ (1s8f B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582207Protein Rab9a [110537] (2 species)
  7. 582208Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry)
  8. 582210Domain d1s8fb_: 1s8f B: [105371]
    complexed with bez, cl, gdp, mg, sr

Details for d1s8fb_

PDB Entry: 1s8f (more details), 1.77 Å

PDB Description: Crystal structure of Rab9 complexed to GDP reveals a dimer with an active conformation of switch II

SCOP Domain Sequences for d1s8fb_:

Sequence, based on SEQRES records: (download)

>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris)}
gamagksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtm
qiwdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfp
fvilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

Sequence, based on observed residues (ATOM records): (download)

>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris)}
gamagksslfkvillgdggvgksslmnryvtnkfdlfhtigveflnkdlevdghfvtmqi
wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl

SCOP Domain Coordinates for d1s8fb_:

Click to download the PDB-style file with coordinates for d1s8fb_.
(The format of our PDB-style files is described here.)

Timeline for d1s8fb_: