![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab9a [110537] (2 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [110538] (1 PDB entry) |
![]() | Domain d1s8fb_: 1s8f B: [105371] complexed with bez, cl, gdp, mg, sr |
PDB Entry: 1s8f (more details), 1.77 Å
SCOP Domain Sequences for d1s8fb_:
Sequence, based on SEQRES records: (download)
>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris)} gamagksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtm qiwdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfp fvilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl
>d1s8fb_ c.37.1.8 (B:) Rab9a {Dog (Canis familiaris)} gamagksslfkvillgdggvgksslmnryvtnkfdlfhtigveflnkdlevdghfvtmqi wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvl
Timeline for d1s8fb_: