SCOPe 2.04: Domain d1s7ca1: 1s7c A:2-148,A:313-331

Lineage for d1s7ca1 (1s7c A:2-148,A:313-331)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
   Uniprot P06977

8. Domain d1s7ca1: 1s7c A:2-148,A:313-331 [105346]
   Other proteins in same PDB: d1s7ca2
   complexed with mes, so4

Details for d1s7ca1

PDB Entry: 1s7c, 2.04 Å

PDB Description: Crystal structure of MES buffer bound form of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli

PDB Compounds: (A:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1s7ca1:

Sequence; same for both SEQRES and ATOM records:

>d1s7ca1 c.2.1.3 (A:2-148,A:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk

Timeline for d1s7ca1:

• d1s7ca1 first appeared in SCOP 1.69
  
• d1s7ca1 appears in SCOPe 2.03
  
• d1s7ca1 appears in SCOPe 2.05
  
• d1s7ca1 appears in the current release, SCOPe 2.08