Lineage for d1s72y_ (1s72 Y:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155945Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 1156000Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 1156001Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 1156002Protein Ribosomal protein L32e [52044] (1 species)
  7. 1156003Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 1156009Domain d1s72y_: 1s72 Y: [105344]
    Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72z_
    complexed with cd, cl, k, mg, na

Details for d1s72y_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1s72y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72y_ c.9.2.1 (Y:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1s72y_:

Click to download the PDB-style file with coordinates for d1s72y_.
(The format of our PDB-style files is described here.)

Timeline for d1s72y_: