Lineage for d1s72n_ (1s72 N:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488796Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 488797Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 488798Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 488799Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries)
  8. 488802Domain d1s72n_: 1s72 N: [105333]
    Other proteins in same PDB: d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_

Details for d1s72n_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

SCOP Domain Sequences for d1s72n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s72n_ c.55.4.1 (N:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1s72n_:

Click to download the PDB-style file with coordinates for d1s72n_.
(The format of our PDB-style files is described here.)

Timeline for d1s72n_: