![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) ![]() |
![]() | Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
![]() | Protein Ribosomal protein L5 [55284] (3 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries) |
![]() | Domain d1s72d_: 1s72 D: [105322] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72d_:
Sequence, based on SEQRES records: (download)
>d1s72d_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev
>d1s72d_ d.77.1.1 (D:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]} fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk hrlnpadavafiestydvev
Timeline for d1s72d_:
![]() Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |