| Class b: All beta proteins [48724] (165 folds) |
| Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) ![]() many known members contain KOW motif |
| Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
| Protein C-terminal domain of ribosomal protein L2 [50115] (2 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) |
| Domain d1s72a1: 1s72 A:91-237 [105318] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1s72 (more details), 2.4 Å
SCOP Domain Sequences for d1s72a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1s72a1:
View in 3DDomains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |