SCOPe 2.08: Domain d1s70b_: 1s70 B:

Lineage for d1s70b_ (1s70 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Myosin phosphatase targeting subunit 1, MYPT1 [110891] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [110892] (1 PDB entry)
   Uniprot Q90623 1-299

8. Domain d1s70b_: 1s70 B: [105317]
   Other proteins in same PDB: d1s70a_
   complexed with mn, pge
   applies to all domains of a family if the common domain is composed of a different number of small repeating units
   has additional insertions and/or extensions that are not grouped together

Details for d1s70b_

PDB Entry: 1s70, 2.7 Å

PDB Description: complex between protein ser/thr phosphatase-1 (delta) and the myosin phosphatase targeting subunit 1 (mypt1)

PDB Compounds: (B:) 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130)

SCOPe Domain Sequences for d1s70b_:

Sequence; same for both SEQRES and ATOM records:

>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]}
mkmadakqkrneqlkrwigsetdleppvvkrkktkvkfddgavflaacssgdteevlrll
ergadinyanvdgltalhqaciddnvdmvkflvenganinqpdnegwiplhaaascgyld
iaeylisqgahvgavnsegdtpldiaeeeameellqnevnrqgvdieaarkeeerimlrd
arqwlnsghindvrhaksggtalhvaaakgytevlklliqarydvnikdydgwtplhaaa
hwgkeeacrilvenlcdmeavnkvgqtafdvadedilgyleelqkkqnllh

Timeline for d1s70b_:

• d1s70b_ first appeared in SCOP 1.69
  
• d1s70b_ appears in SCOPe 2.07