Lineage for d1s69a_ (1s69 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685881Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2685932Species Synechocystis sp. PCC 6803 [TaxId:1148] [81667] (7 PDB entries)
    Uniprot P73925
  8. 2685933Domain d1s69a_: 1s69 A: [105305]
    complexed with cyn, flc, hem

Details for d1s69a_

PDB Entry: 1s69 (more details), 1.68 Å

PDB Description: The X-ray structure of the cyanobacteria Synechocystis hemoglobin "cyanoglobin" with cyanide ligand
PDB Compounds: (A:) Cyanoglobin

SCOPe Domain Sequences for d1s69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOPe Domain Coordinates for d1s69a_:

Click to download the PDB-style file with coordinates for d1s69a_.
(The format of our PDB-style files is described here.)

Timeline for d1s69a_: