Lineage for d1s61b_ (1s61 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901764Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 901765Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 901774Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 901786Domain d1s61b_: 1s61 B: [105284]
    complexed with cyn, hec, hem, k, nbn, po4

Details for d1s61b_

PDB Entry: 1s61 (more details), 2.1 Å

PDB Description: crystal structure of "truncated" hemoglobin n (hbn) from mycobacterium tuberculosis, soaked with butyl-isocyanide
PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1s61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s61b_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsgesttapv

SCOPe Domain Coordinates for d1s61b_:

Click to download the PDB-style file with coordinates for d1s61b_.
(The format of our PDB-style files is described here.)

Timeline for d1s61b_: